Recombinant Human EPHB6 Protein, GST-tagged
Cat.No. : | EPHB6-3406H |
Product Overview : | Human EPHB6 partial ORF ( NP_004436, 23 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPHB6 EPH receptor B6 [ Homo sapiens ] |
Official Symbol | EPHB6 |
Synonyms | EPHB6; EPH receptor B6; EphB6; ephrin type-B receptor 6; HEP; tyrosine-protein kinase-defective receptor EPH-6; MGC129910; MGC129911; |
Gene ID | 2051 |
mRNA Refseq | NM_004445 |
Protein Refseq | NP_004436 |
MIM | 602757 |
UniProt ID | O15197 |
◆ Recombinant Proteins | ||
Ephb6-498M | Active Recombinant Mouse Ephb6, His-tagged | +Inquiry |
EPHB6-1181C | Active Recombinant Cynomolgus EPHB6 Protein, Fc-tagged | +Inquiry |
EPHB6-3152H | Recombinant Human EphB6 protein(Met1-Ser579), His-tagged | +Inquiry |
EPHB6-1485R | Recombinant Rhesus monkey EPHB6 Protein, His-tagged | +Inquiry |
EPHB6-935H | Active Recombinant Human EPHB6 Protein, Fc Chimera | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHB6-1319CCL | Recombinant Cynomolgus EPHB6 cell lysate | +Inquiry |
EPHB6-2421HCL | Recombinant Human EPHB6 cell lysate | +Inquiry |
EPHB6-001MCL | Recombinant Mouse EPHB6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHB6 Products
Required fields are marked with *
My Review for All EPHB6 Products
Required fields are marked with *