Recombinant Human EPHB6 Protein, GST-tagged

Cat.No. : EPHB6-3406H
Product Overview : Human EPHB6 partial ORF ( NP_004436, 23 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Molecular Mass : 36.63 kDa
AA Sequence : DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPHB6 EPH receptor B6 [ Homo sapiens ]
Official Symbol EPHB6
Synonyms EPHB6; EPH receptor B6; EphB6; ephrin type-B receptor 6; HEP; tyrosine-protein kinase-defective receptor EPH-6; MGC129910; MGC129911;
Gene ID 2051
mRNA Refseq NM_004445
Protein Refseq NP_004436
MIM 602757
UniProt ID O15197

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHB6 Products

Required fields are marked with *

My Review for All EPHB6 Products

Required fields are marked with *

0
cart-icon