Recombinant Human EPO protein(28-193 aa), N-MBP-His-tagged
| Cat.No. : | EPO-2521H |
| Product Overview : | Recombinant Human EPO protein(P01588)(28-193 aa), fused with N-terminal MBP-His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 28-193 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Gene Name | EPO erythropoietin [ Homo sapiens ] |
| Official Symbol | EPO |
| Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
| Gene ID | 2056 |
| mRNA Refseq | NM_000799 |
| Protein Refseq | NP_000790 |
| MIM | 133170 |
| UniProt ID | P01588 |
| ◆ Recombinant Proteins | ||
| Epo-603M | Recombinant Mouse Epo protein, His & S-tagged | +Inquiry |
| EPO-4401H | Recombinant Human EPO Protein, His (Fc)-Avi-tagged | +Inquiry |
| Epo-4376M | Recombinant Mouse Epo Protein | +Inquiry |
| EPO-517H | Recombinant Human EPO protein | +Inquiry |
| EPO-1432R | Recombinant Rhesus monkey EPO Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| cEPO-01H | Recombinant Human Carbomylated Erythropoietin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
| EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
