Recombinant Human EPO protein(28-193 aa), N-MBP-His-tagged
Cat.No. : | EPO-2521H |
Product Overview : | Recombinant Human EPO protein(P01588)(28-193 aa), fused with N-terminal MBP-His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 28-193 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Gene Name | EPO erythropoietin [ Homo sapiens ] |
Official Symbol | EPO |
Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
Gene ID | 2056 |
mRNA Refseq | NM_000799 |
Protein Refseq | NP_000790 |
MIM | 133170 |
UniProt ID | P01588 |
◆ Recombinant Proteins | ||
EPO-355H | Recombinant Human EPO protein | +Inquiry |
EPO-2524H | Recombinant Human EPO Protein (Ala28-Arg193), N-His tagged | +Inquiry |
EPO-602H | Recombinant Human EPO protein, His & GST-tagged | +Inquiry |
Epo-01R | Active Recombinant Rat Epo protein, His-tagged | +Inquiry |
EPO-363H | Active Recombinant Human EPO Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *