Recombinant Human EPO protein(28-193 aa), N-MBP-His-tagged

Cat.No. : EPO-2521H
Product Overview : Recombinant Human EPO protein(P01588)(28-193 aa), fused with N-terminal MBP-His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&MBP
Protein Length : 28-193 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Gene Name EPO erythropoietin [ Homo sapiens ]
Official Symbol EPO
Synonyms EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142;
Gene ID 2056
mRNA Refseq NM_000799
Protein Refseq NP_000790
MIM 133170
UniProt ID P01588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPO Products

Required fields are marked with *

My Review for All EPO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon