Recombinant Human EPO therapeutic protein(Erythropoietin)
Cat.No. : | EPO-P011H |
Product Overview : | Human erythropoietin (recombinant), produced by CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 166 Aa |
Description : | This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.The expression product is the active ingredient of Epogen, Epogin, Epomax, Eprex, NeoRecormon, Procrit, Recormon, Dynepo and Procrit. |
Molecular Mass : | 18.4 Kda |
AA Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLS EAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLF RVYSNFLRGKLKLYTGEACRTGDR |
Endotoxin : | < 0.1 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | EPO; EP; MVCD2; Erythropoietin |
Gene Name | EPO erythropoietin [ Homo sapiens ] |
Official Symbol | EPO |
Synonyms | EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142; |
Gene ID | 2056 |
mRNA Refseq | NM_000799 |
Protein Refseq | NP_000790 |
MIM | 133170 |
UniProt ID | P01588 |
Chromosome Location | 7q21 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; |
Function | erythropoietin receptor binding; eukaryotic cell surface binding; hormone activity; protein binding; protein kinase activator activity; |
◆ Recombinant Proteins | ||
EPO-1312R | Recombinant Rhesus Macaque EPO Protein, His (Fc)-Avi-tagged | +Inquiry |
EPO-2521H | Recombinant Human EPO protein(28-193 aa), N-MBP-His-tagged | +Inquiry |
EPO-2858B | Recombinant Bovine EPO protein, His-SUMO-tagged | +Inquiry |
EPO-269H | Active Recombinant Human Erythropoietin | +Inquiry |
Epo-523R | Recombinant Rat Epo Protein(Pro28~Arg192), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *