Recombinant Human EPS8L2, His-tagged
Cat.No. : | EPS8L2-28683TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 559-731 of Human EPS8L2 with a N terminal His tag; 32kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 559-731 a.a. |
Description : | This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 103 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CNILGEARPEDAGAPFEQAGQKYWGPASPTHKLPPSFPGN KDELMQHMDEVNDELIRKISNIRAQPQRHFRVERSQPV SQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQL FSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELE ELMNKFHSMNQRRGEDS |
Gene Name | EPS8L2 EPS8-like 2 [ Homo sapiens ] |
Official Symbol | EPS8L2 |
Synonyms | EPS8L2; EPS8-like 2; epidermal growth factor receptor kinase substrate 8-like protein 2; FLJ21935; FLJ22171; MGC3088; |
Gene ID | 64787 |
mRNA Refseq | NM_022772 |
Protein Refseq | NP_073609 |
Uniprot ID | Q9H6S3 |
Chromosome Location | 11p15.5 |
◆ Recombinant Proteins | ||
Eps8l2-2848M | Recombinant Mouse Eps8l2 Protein, Myc/DDK-tagged | +Inquiry |
EPS8L2-5268M | Recombinant Mouse EPS8L2 Protein | +Inquiry |
EPS8L2-5700H | Recombinant Human EPS8L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EPS8L2-12507H | Recombinant Human EPS8L2, His-tagged | +Inquiry |
EPS8L2-28683TH | Recombinant Human EPS8L2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPS8L2-571HCL | Recombinant Human EPS8L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPS8L2 Products
Required fields are marked with *
My Review for All EPS8L2 Products
Required fields are marked with *
0
Inquiry Basket