Recombinant Human ERAS Protein (3-230 aa), His-tagged
| Cat.No. : | ERAS-1261H |
| Product Overview : | Recombinant Human ERAS Protein (3-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3-230 aa |
| Description : | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of bryonic st cells. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.8 kDa |
| AA Sequence : | LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | ERAS ES cell expressed Ras [ Homo sapiens ] |
| Official Symbol | ERAS |
| Synonyms | ERAS; GTPase ERas; E-Ras; HRAS2; HRASP; MGC126691; MGC126693; |
| Gene ID | 3266 |
| mRNA Refseq | NM_181532 |
| Protein Refseq | NP_853510 |
| MIM | 300437 |
| UniProt ID | Q7Z444 |
| ◆ Recombinant Proteins | ||
| ERAS-4357HF | Recombinant Full Length Human ERAS Protein, GST-tagged | +Inquiry |
| Eras-2852M | Recombinant Mouse Eras Protein, Myc/DDK-tagged | +Inquiry |
| ERAS-1490R | Recombinant Rhesus monkey ERAS Protein, His-tagged | +Inquiry |
| ERAS-1972H | Recombinant Human ERAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ERAS-716HFL | Recombinant Full Length Human ERAS Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ERAS-6570HCL | Recombinant Human ERAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERAS Products
Required fields are marked with *
My Review for All ERAS Products
Required fields are marked with *
