Recombinant Human ERAS Protein (3-230 aa), His-tagged
Cat.No. : | ERAS-1261H |
Product Overview : | Recombinant Human ERAS Protein (3-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-230 aa |
Description : | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of bryonic st cells. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.8 kDa |
AA Sequence : | LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ERAS ES cell expressed Ras [ Homo sapiens ] |
Official Symbol | ERAS |
Synonyms | ERAS; GTPase ERas; E-Ras; HRAS2; HRASP; MGC126691; MGC126693; |
Gene ID | 3266 |
mRNA Refseq | NM_181532 |
Protein Refseq | NP_853510 |
MIM | 300437 |
UniProt ID | Q7Z444 |
◆ Recombinant Proteins | ||
ERAS-1315R | Recombinant Rhesus Macaque ERAS Protein, His (Fc)-Avi-tagged | +Inquiry |
ERAS-716HFL | Recombinant Full Length Human ERAS Protein, C-Flag-tagged | +Inquiry |
Eras-2852M | Recombinant Mouse Eras Protein, Myc/DDK-tagged | +Inquiry |
ERAS-1261H | Recombinant Human ERAS Protein (3-230 aa), His-tagged | +Inquiry |
ERAS-1972H | Recombinant Human ERAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERAS-6570HCL | Recombinant Human ERAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERAS Products
Required fields are marked with *
My Review for All ERAS Products
Required fields are marked with *
0
Inquiry Basket