Recombinant Human ERBIN Protein, GST-tagged

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Molecular Mass :	36.74 kDa
AA Sequence :	QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	ERBIN erbb2 interacting protein [ Homo sapiens (human) ]
Official Symbol	ERBIN
Synonyms	ERBIN; erbb2 interacting protein; ERBB2IP; erbb2 interacting protein; protein LAP2; densin 180 like protein; ERBB2 interacting protein; ERBIN; LAP2; densin-180-like protein;
Gene ID	55914
mRNA Refseq	NM_001006600
Protein Refseq	NP_001006600
MIM	606944
UniProt ID	Q96RT1