Recombinant Human ERC1 Protein, GST-tagged
Cat.No. : | ERC1-3453H |
Product Overview : | Human ERC1 full-length ORF ( AAH05065.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13) in thyroid papillary carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 36.4 kDa |
AA Sequence : | MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERC1 ELKS/RAB6-interacting/CAST family member 1 [ Homo sapiens ] |
Official Symbol | ERC1 |
Synonyms | ERC1; ELKS/RAB6-interacting/CAST family member 1; RAB6 interacting protein 2 , RAB6IP2; ELKS/Rab6-interacting/CAST family member 1; CAST2; ELKS; KIAA1081; MGC12974; RAB6 interacting protein 2; Rab6-interacting protein 2; Cast2; RAB6IP2; FLJ31750; |
Gene ID | 23085 |
mRNA Refseq | NM_178039 |
Protein Refseq | NP_829883 |
MIM | 607127 |
UniProt ID | Q8IUD2 |
◆ Recombinant Proteins | ||
ERC1-2135R | Recombinant Rat ERC1 Protein | +Inquiry |
ERC1-4087H | Recombinant Human ERC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERC1-4526HF | Recombinant Full Length Human ERC1 Protein, GST-tagged | +Inquiry |
ERC1-806HFL | Recombinant Full Length Human ERC1 Protein, C-Flag-tagged | +Inquiry |
ERC1-860H | Recombinant Human ERC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERC1-1024HCL | Recombinant Human ERC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERC1 Products
Required fields are marked with *
My Review for All ERC1 Products
Required fields are marked with *