Recombinant Human ERC1 Protein, GST-tagged

• Cat.No.: ERC1-3453H
• Product Overview: Human ERC1 full-length ORF ( AAH05065.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13) in thyroid papillary carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Molecular Mass: 36.4 kDa
• AA Sequence: MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERC1 ELKS/RAB6-interacting/CAST family member 1 [ Homo sapiens ]
• Official Symbol: ERC1
• Synonyms: ERC1; ELKS/RAB6-interacting/CAST family member 1; RAB6 interacting protein 2 , RAB6IP2; ELKS/Rab6-interacting/CAST family member 1; CAST2; ELKS; KIAA1081; MGC12974; RAB6 interacting protein 2; Rab6-interacting protein 2; Cast2; RAB6IP2; FLJ31750
• Gene ID: 23085
• mRNA Refseq: NM_178039
• Protein Refseq: NP_829883
• MIM: 607127
• UniProt ID: Q8IUD2