Recombinant Human ERC1 Protein, GST-tagged

Cat.No. : ERC1-3453H
Product Overview : Human ERC1 full-length ORF ( AAH05065.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13) in thyroid papillary carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 36.4 kDa
AA Sequence : MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERC1 ELKS/RAB6-interacting/CAST family member 1 [ Homo sapiens ]
Official Symbol ERC1
Synonyms ERC1; ELKS/RAB6-interacting/CAST family member 1; RAB6 interacting protein 2 , RAB6IP2; ELKS/Rab6-interacting/CAST family member 1; CAST2; ELKS; KIAA1081; MGC12974; RAB6 interacting protein 2; Rab6-interacting protein 2; Cast2; RAB6IP2; FLJ31750;
Gene ID 23085
mRNA Refseq NM_178039
Protein Refseq NP_829883
MIM 607127
UniProt ID Q8IUD2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERC1 Products

Required fields are marked with *

My Review for All ERC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon