Recombinant Human ERCC5 protein, His-tagged

Cat.No. : ERCC5-2868H
Product Overview : Recombinant Human ERCC5 protein(P28715)(947-1186aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 947-1186aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.8 kDa
AA Sequence : SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ERCC5 excision repair cross-complementing rodent repair deficiency, complementation group 5 [ Homo sapiens ]
Official Symbol ERCC5
Synonyms ERCC5; excision repair cross-complementing rodent repair deficiency, complementation group 5; ERCM2, xeroderma pigmentosum, complementation group G , XPGC; DNA repair protein complementing XP-G cells; Cockayne syndrome; XPG-complementing protein; DNA excision repair protein ERCC-5; xeroderma pigmentosum, complementation group G; XPG; UVDR; XPGC; COFS3; ERCM2;
Gene ID 2073
mRNA Refseq NM_000123
Protein Refseq NP_000114
MIM 133530
UniProt ID P28715

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERCC5 Products

Required fields are marked with *

My Review for All ERCC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon