Recombinant Human ERCC5 protein, His-tagged

• Cat.No.: ERCC5-2868H
• Product Overview: Recombinant Human ERCC5 protein(P28715)(947-1186aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 947-1186aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.8 kDa
• AA Sequence: SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ERCC5 excision repair cross-complementing rodent repair deficiency, complementation group 5 [ Homo sapiens ]
• Official Symbol: ERCC5
• Synonyms: ERCC5; excision repair cross-complementing rodent repair deficiency, complementation group 5; ERCM2, xeroderma pigmentosum, complementation group G , XPGC; DNA repair protein complementing XP-G cells; Cockayne syndrome; XPG-complementing protein; DNA excision repair protein ERCC-5; xeroderma pigmentosum, complementation group G; XPG; UVDR; XPGC; COFS3; ERCM2
• Gene ID: 2073
• mRNA Refseq: NM_000123
• Protein Refseq: NP_000114
• MIM: 133530
• UniProt ID: P28715