Recombinant Human ERGIC3 protein, His-tagged

• Cat.No.: ERGIC3-3560H
• Product Overview: Recombinant Human ERGIC3 protein(44-383 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 44-383 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ERGIC3 ERGIC and golgi 3 [ Homo sapiens ]
• Official Symbol: ERGIC3
• Synonyms: ERGIC3; ERGIC and golgi 3; C20orf47, chromosome 20 open reading frame 47 , SDBCAG84, serologically defined breast cancer antigen 84; endoplasmic reticulum-Golgi intermediate compartment protein 3; CGI 54; Erv46; NY BR 84; PRO0989; endoplasmic reticulum-localized protein ERp43; serologically defined breast cancer antigen 84; serologically defined breast cancer antigen NY-BR-84; CGI-54; C20orf47; NY-BR-84; SDBCAG84; dJ477O4.2
• Gene ID: 51614
• mRNA Refseq: NM_015966
• Protein Refseq: NP_057050
• UniProt ID: Q9Y282