Recombinant Human ERGIC3 protein, His-tagged
Cat.No. : | ERGIC3-3560H |
Product Overview : | Recombinant Human ERGIC3 protein(44-383 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 44-383 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ERGIC3 ERGIC and golgi 3 [ Homo sapiens ] |
Official Symbol | ERGIC3 |
Synonyms | ERGIC3; ERGIC and golgi 3; C20orf47, chromosome 20 open reading frame 47 , SDBCAG84, serologically defined breast cancer antigen 84; endoplasmic reticulum-Golgi intermediate compartment protein 3; CGI 54; Erv46; NY BR 84; PRO0989; endoplasmic reticulum-localized protein ERp43; serologically defined breast cancer antigen 84; serologically defined breast cancer antigen NY-BR-84; CGI-54; C20orf47; NY-BR-84; SDBCAG84; dJ477O4.2; |
Gene ID | 51614 |
mRNA Refseq | NM_015966 |
Protein Refseq | NP_057050 |
UniProt ID | Q9Y282 |
◆ Recombinant Proteins | ||
ERGIC3-3560H | Recombinant Human ERGIC3 protein, His-tagged | +Inquiry |
ERGIC3-1571H | Recombinant Human ERGIC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERGIC3-12533H | Recombinant Human ERGIC3, GST-tagged | +Inquiry |
ERGIC3-4967H | Recombinant Human ERGIC3 protein, His-SUMO-tagged | +Inquiry |
RFL19563XF | Recombinant Full Length Xenopus Laevis Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 3(Ergic3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERGIC3-6556HCL | Recombinant Human ERGIC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERGIC3 Products
Required fields are marked with *
My Review for All ERGIC3 Products
Required fields are marked with *
0
Inquiry Basket