Recombinant Human ERH Protein, GST-tagged

• Cat.No.: ERH-3476H
• Product Overview: Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ERH (Enhancer Of Rudimentary Homolog (Drosophila)) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
• Molecular Mass: 37.18 kDa
• AA Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: ERH
• Synonyms: ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340
• Gene ID: 2079
• mRNA Refseq: NM_004450
• Protein Refseq: NP_004441
• MIM: 601191
• UniProt ID: P84090