Recombinant Human ERH Protein, GST-tagged
| Cat.No. : | ERH-3476H |
| Product Overview : | Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ERH (Enhancer Of Rudimentary Homolog (Drosophila)) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
| Molecular Mass : | 37.18 kDa |
| AA Sequence : | MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | ERH |
| Synonyms | ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340; |
| Gene ID | 2079 |
| mRNA Refseq | NM_004450 |
| Protein Refseq | NP_004441 |
| MIM | 601191 |
| UniProt ID | P84090 |
| ◆ Recombinant Proteins | ||
| Erh-974M | Recombinant Mouse Erh Protein, MYC/DDK-tagged | +Inquiry |
| ERH-493H | Recombinant Human ERH protein(Met1-Lys104), His-tagged | +Inquiry |
| ERH-12534H | Recombinant Human ERH, GST-tagged | +Inquiry |
| ERH-8274Z | Recombinant Zebrafish ERH | +Inquiry |
| ERH-1317R | Recombinant Rhesus Macaque ERH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ERH-6555HCL | Recombinant Human ERH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERH Products
Required fields are marked with *
My Review for All ERH Products
Required fields are marked with *




