Recombinant Human ERICH6 Protein, GST-tagged
| Cat.No. : | ERICH6-5215H |
| Product Overview : | Human C3orf44 full-length ORF ( AAH29577.1, 1 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ERICH6 (Glutamate Rich 6) is a Protein Coding gene. An important paralog of this gene is ERICH6B. |
| Molecular Mass : | 85 kDa |
| AA Sequence : | MSEMSIDRNIHRNLSPGIPVSVQTEESWLQDLSDKVQSRKKASKEKAEPECLASKLREKWVINPEESKLNILYELEFKEDFITLFEPSLRTLPSIGPPSILAYKEESSNLGINFKDEEEETSPKCEFCGSDLRAFFSNVDVSSEPKGHASCCIAFQNLIDYIYEEQIKTKPPKAELIAIDPHAAHGSEVDRLKAKEKALQRKQEQRMARHFAIISREQTHFSEDDSKRLKTISYQLSVDIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELLEKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVNGFTCIVQEDMPTNPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNSITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIRRLFHKLEGCVNFPSSQVWEKLKQPSYLSSLSLKLIALCHSSGIKQDIMKTIRNIINEEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ERICH6 glutamate rich 6 [ Homo sapiens (human) ] |
| Official Symbol | ERICH6 |
| Synonyms | ERICH6; glutamate rich 6; C3orf44; ERICH6A; FAM194A; glutamate-rich protein 6; family with sequence similarity 194, member A; glutamate-rich 6A; protein FAM194A; Glutamate Rich 6; Family With Sequence Similarity 194, Member A; Glutamate-Rich 6A; Protein FAM194A; Chromosome 3 Open Reading Frame 44; Glutamate-Rich Protein 6; Glutamate-Rich 6; ERICH6A |
| Gene ID | 131831 |
| mRNA Refseq | NM_001308234 |
| Protein Refseq | NP_001295163 |
| UniProt ID | Q7L0X2 |
| ◆ Recombinant Proteins | ||
| ERICH6-3838HF | Recombinant Full Length Human ERICH6 Protein, GST-tagged | +Inquiry |
| ERICH6-5215H | Recombinant Human ERICH6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERICH6 Products
Required fields are marked with *
My Review for All ERICH6 Products
Required fields are marked with *
