Recombinant Human ERP44 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ERP44-5199H |
| Product Overview : | ERP44 MS Standard C13 and N15-labeled recombinant protein (NP_055866) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. It has an inferred N-terminal signal peptide, a catalytically active thioredoxin (TRX) domain, two TRX-like domains and a C-terminal ER-retention sequence. This protein functions as a pH-regulated chaperone of the secretory pathway and likely plays a role in protein quality control at the endoplasmic reticulum - Golgi interface. |
| Molecular Mass : | 47 kDa |
| AA Sequence : | MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ERP44 endoplasmic reticulum protein 44 [ Homo sapiens (human) ] |
| Official Symbol | ERP44 |
| Synonyms | ERP44; endoplasmic reticulum protein 44; thioredoxin domain containing 4 (endoplasmic reticulum), TXNDC4; endoplasmic reticulum resident protein 44; KIAA0573; PDIA10; protein disulfide isomerase family A; member 10; ER protein 44; thioredoxin domain-containing protein 4; endoplasmic reticulum resident protein 44 kDa; protein disulfide isomerase family A, member 10; thioredoxin domain containing 4 (endoplasmic reticulum); TXNDC4; |
| Gene ID | 23071 |
| mRNA Refseq | NM_015051 |
| Protein Refseq | NP_055866 |
| MIM | 609170 |
| UniProt ID | Q9BS26 |
| ◆ Recombinant Proteins | ||
| ERP44-11137Z | Recombinant Zebrafish ERP44 | +Inquiry |
| ERP44-30128TH | Recombinant Human ERP44, His-tagged | +Inquiry |
| ERP44-2790H | Recombinant Human Endoplasmic Reticulum Protein 44, His-tagged | +Inquiry |
| ERP44-646H | Recombinant Human ERP44 protein(Met1-Asp402), His-tagged | +Inquiry |
| ERP44-1442H | Recombinant Human ERP44 Protein, His&GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ERP44-6543HCL | Recombinant Human ERP44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERP44 Products
Required fields are marked with *
My Review for All ERP44 Products
Required fields are marked with *
