Recombinant Human ESAM Protein, GST-tagged
| Cat.No. : | ESAM-3494H |
| Product Overview : | Human ESAM full-length ORF ( AAH16868, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ESAM (Endothelial Cell Adhesion Molecule) is a Protein Coding gene. Among its related pathways are Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways and Integrin Pathway. An important paralog of this gene is IGSF11. |
| Molecular Mass : | 68.64 kDa |
| AA Sequence : | MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ESAM endothelial cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | ESAM |
| Synonyms | ESAM; endothelial cell adhesion molecule; endothelial cell-selective adhesion molecule; W117m; 2310008D05Rik; LP4791 protein; HUEL (C4orf1)-interacting protein; |
| Gene ID | 90952 |
| mRNA Refseq | NM_138961 |
| Protein Refseq | NP_620411 |
| MIM | 614281 |
| UniProt ID | Q96AP7 |
| ◆ Recombinant Proteins | ||
| ESAM-1219H | Recombinant Human ESAM protein, His-tagged | +Inquiry |
| ESAM-943M | Recombinant Mouse ESAM Protein, His-tagged | +Inquiry |
| Esam-1221R | Recombinant Rat Esam protein, His & S-tagged | +Inquiry |
| ESAM-1502R | Recombinant Rhesus monkey ESAM Protein, His-tagged | +Inquiry |
| ESAM-701H | Recombinant Human ESAM protein(Met1-Ala248) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESAM-2961HCL | Recombinant Human ESAM cell lysate | +Inquiry |
| ESAM-1579MCL | Recombinant Mouse ESAM cell lysate | +Inquiry |
| ESAM-1569RCL | Recombinant Rat ESAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESAM Products
Required fields are marked with *
My Review for All ESAM Products
Required fields are marked with *



