Recombinant Human ESR2 protein, His-SUMO-tagged
| Cat.No. : | ESR2-2873H |
| Product Overview : | Recombinant Human ESR2 protein(Q92731)(2-323aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-323aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ESR2 estrogen receptor 2 (ER beta) [ Homo sapiens ] |
| Official Symbol | ESR2 |
| Synonyms | ESR2; estrogen receptor 2 (ER beta); estrogen receptor beta; Erb; NR3A2; estrogen receptor beta 4; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; nuclear receptor subfamily 3 group A member 2; ESRB; ESTRB; ER-BETA; ESR-BETA; |
| Gene ID | 2100 |
| mRNA Refseq | NM_001040275 |
| Protein Refseq | NP_001035365 |
| MIM | 601663 |
| UniProt ID | Q92731 |
| ◆ Recombinant Proteins | ||
| ESR2-6357C | Recombinant Chicken ESR2 | +Inquiry |
| ESR2-1391H | Recombinant Human ESR2 Protein (2-530 aa), His-tagged | +Inquiry |
| ESR2-2670H | Recombinant Human ESR2 Protein (Met1-Ala323), N-His tagged | +Inquiry |
| ESR2-103H | Recombinant Human Estrogen beta receptor LBD/Hsp90 complex, GST-tagged | +Inquiry |
| ESR2-7H | Recombinant Human ESR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESR2-6539HCL | Recombinant Human ESR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR2 Products
Required fields are marked with *
My Review for All ESR2 Products
Required fields are marked with *



