Recombinant Human ESR2 protein, His-SUMO-tagged

Cat.No. : ESR2-2873H
Product Overview : Recombinant Human ESR2 protein(Q92731)(2-323aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-323aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.9 kDa
AA Sequence : DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ESR2 estrogen receptor 2 (ER beta) [ Homo sapiens ]
Official Symbol ESR2
Synonyms ESR2; estrogen receptor 2 (ER beta); estrogen receptor beta; Erb; NR3A2; estrogen receptor beta 4; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; nuclear receptor subfamily 3 group A member 2; ESRB; ESTRB; ER-BETA; ESR-BETA;
Gene ID 2100
mRNA Refseq NM_001040275
Protein Refseq NP_001035365
MIM 601663
UniProt ID Q92731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ESR2 Products

Required fields are marked with *

My Review for All ESR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon