Recombinant Human ESX1 Protein, GST-tagged
Cat.No. : | ESX1-3513H |
Product Overview : | Human ESX1L partial ORF ( NP_703149, 124 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes exclusively to the nucleus. In contrast to human, the mouse homolog has a novel PN/PF motif in the C-terminus and is paternally imprinted in placental tissue. This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | AEGPQTAEGPQPPERKRRRRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTEDRVQVWFQNRRAKWKRNQRVLMLRNTATADLAH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ESX1 ESX homeobox 1 [ Homo sapiens ] |
Official Symbol | ESX1 |
Synonyms | ESX1; ESX homeobox 1; ESX1L, extraembryonic, spermatogenesis, homeobox 1 homolog (mouse); homeobox protein ESX1; ESXR1; ESX1-related protein; extraembryonic, spermatogenesis, homeobox 1 homolog; ESX1L; |
Gene ID | 80712 |
mRNA Refseq | NM_153448 |
Protein Refseq | NP_703149 |
MIM | 300154 |
UniProt ID | Q8N693 |
◆ Recombinant Proteins | ||
ESX1-3513H | Recombinant Human ESX1 Protein, GST-tagged | +Inquiry |
ESX1-12563H | Recombinant Human ESX1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESX1 Products
Required fields are marked with *
My Review for All ESX1 Products
Required fields are marked with *