Recombinant Human ETFA, His-tagged

• Cat.No.: ETFA-28858TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-284 of Human MADD with N terminal His Tag; Predicted MWt 31 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-284 a.a.
• Description: ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 88 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MFRAAAPGQLRRAVAQDLCKVAGIAKVLVAQHDVYKGLLP EELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKL EVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKV FSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQKLT KSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHA AVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGIS GAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADL FKVVPEMTEILKKK
• Sequence Similarities: Belongs to the ETF alpha-subunit/fixB family.
• Full Length: Full L.

Gene Information

• Gene Name: ETFA electron-transfer-flavoprotein, alpha polypeptide [ Homo sapiens ]
• Official Symbol: ETFA
• Synonyms: ETFA; electron-transfer-flavoprotein, alpha polypeptide; electron transfer flavoprotein subunit alpha, mitochondrial; EMA; GA2; glutaric aciduria II; MADD
• Gene ID: 2108
• mRNA Refseq: NM_000126
• Protein Refseq: NP_000117
• MIM: 608053
• Uniprot ID: P13804
• Chromosome Location: 15q23-q25
• Pathway: Metabolism, organism-specific biosystem; Respiratory electron transport, organism-specific biosystem; Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins., organism-specific biosystem; The citric acid (TCA) cycle and respiratory electron transport, organism-specific biosystem
• Function: electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity