Recombinant Human ETFA, His-tagged

Cat.No. : ETFA-28858TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-284 of Human MADD with N terminal His Tag; Predicted MWt 31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-284 a.a.
Description : ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MFRAAAPGQLRRAVAQDLCKVAGIAKVLVAQHDVYKGLLP EELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKL EVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKV FSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQKLT KSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHA AVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGIS GAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADL FKVVPEMTEILKKK
Sequence Similarities : Belongs to the ETF alpha-subunit/fixB family.
Full Length : Full L.
Gene Name ETFA electron-transfer-flavoprotein, alpha polypeptide [ Homo sapiens ]
Official Symbol ETFA
Synonyms ETFA; electron-transfer-flavoprotein, alpha polypeptide; electron transfer flavoprotein subunit alpha, mitochondrial; EMA; GA2; glutaric aciduria II; MADD;
Gene ID 2108
mRNA Refseq NM_000126
Protein Refseq NP_000117
MIM 608053
Uniprot ID P13804
Chromosome Location 15q23-q25
Pathway Metabolism, organism-specific biosystem; Respiratory electron transport, organism-specific biosystem; Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins., organism-specific biosystem; The citric acid (TCA) cycle and respiratory electron transport, organism-specific biosystem;
Function electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETFA Products

Required fields are marked with *

My Review for All ETFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon