Recombinant Human ETFA, His-tagged
Cat.No. : | ETFA-28858TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-284 of Human MADD with N terminal His Tag; Predicted MWt 31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-284 a.a. |
Description : | ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFRAAAPGQLRRAVAQDLCKVAGIAKVLVAQHDVYKGLLP EELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKL EVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKV FSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQKLT KSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHA AVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGIS GAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADL FKVVPEMTEILKKK |
Sequence Similarities : | Belongs to the ETF alpha-subunit/fixB family. |
Full Length : | Full L. |
Gene Name | ETFA electron-transfer-flavoprotein, alpha polypeptide [ Homo sapiens ] |
Official Symbol | ETFA |
Synonyms | ETFA; electron-transfer-flavoprotein, alpha polypeptide; electron transfer flavoprotein subunit alpha, mitochondrial; EMA; GA2; glutaric aciduria II; MADD; |
Gene ID | 2108 |
mRNA Refseq | NM_000126 |
Protein Refseq | NP_000117 |
MIM | 608053 |
Uniprot ID | P13804 |
Chromosome Location | 15q23-q25 |
Pathway | Metabolism, organism-specific biosystem; Respiratory electron transport, organism-specific biosystem; Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins., organism-specific biosystem; The citric acid (TCA) cycle and respiratory electron transport, organism-specific biosystem; |
Function | electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
ETFA-243C | Recombinant Cynomolgus Monkey ETFA Protein, His (Fc)-Avi-tagged | +Inquiry |
ETFA-28858TH | Recombinant Human ETFA, His-tagged | +Inquiry |
ETFA-2874H | Recombinant Human ETFA protein, GST-tagged | +Inquiry |
ETFA-2257C | Recombinant Chicken ETFA | +Inquiry |
ETFA-6532H | Recombinant Human ETFA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETFA-6532HCL | Recombinant Human ETFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETFA Products
Required fields are marked with *
My Review for All ETFA Products
Required fields are marked with *