Recombinant Human ETS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ETS1-1083H |
Product Overview : | ETS1 MS Standard C13 and N15-labeled recombinant protein (NP_005229) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ETS1 ETS proto-oncogene 1, transcription factor [ Homo sapiens (human) ] |
Official Symbol | ETS1 |
Synonyms | ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; p54; v-ets avian erythroblastosis virus E2 oncogene homolog 1; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ETS-1; EWSR2; |
Gene ID | 2113 |
mRNA Refseq | NM_005238 |
Protein Refseq | NP_005229 |
MIM | 164720 |
UniProt ID | P14921 |
◆ Recombinant Proteins | ||
ETS1-1819R | Recombinant Rat ETS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETS1-722HFL | Recombinant Full Length Human ETS1 Protein, C-Flag-tagged | +Inquiry |
ETS1-901H | Recombinant Human ETS1 Protein, His-tagged | +Inquiry |
Ets1-1647M | Recombinant Mouse Ets1 protein, His & T7-tagged | +Inquiry |
ETS1-900H | Recombinant Human ETS1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETS1-6526HCL | Recombinant Human ETS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETS1 Products
Required fields are marked with *
My Review for All ETS1 Products
Required fields are marked with *