Recombinant Human ETV1

Cat.No. : ETV1-28687TH
Product Overview : Recombinant fragment of amino acids 148-257 Human ER81 with a proprietary tag at N-terminal, predicted MolWt 37.73 kDa including the tag,.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Very highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in placenta and periphera
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Sequence Similarities : Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name ETV1 ets variant 1 [ Homo sapiens ]
Official Symbol ETV1
Synonyms ETV1; ets variant 1; ets variant gene 1; ETS translocation variant 1; ER81;
Gene ID 2115
mRNA Refseq NM_001163147
Protein Refseq NP_001156619
MIM 600541
Uniprot ID P50549
Chromosome Location 7p22
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; p38 signaling mediated by MAPKAP kinases, organism-specific biosystem;
Function protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETV1 Products

Required fields are marked with *

My Review for All ETV1 Products

Required fields are marked with *

0
cart-icon
0
compare icon