Recombinant Human ETV1
Cat.No. : | ETV1-28687TH |
Product Overview : | Recombinant fragment of amino acids 148-257 Human ER81 with a proprietary tag at N-terminal, predicted MolWt 37.73 kDa including the tag,. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Very highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in placenta and periphera |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name | ETV1 ets variant 1 [ Homo sapiens ] |
Official Symbol | ETV1 |
Synonyms | ETV1; ets variant 1; ets variant gene 1; ETS translocation variant 1; ER81; |
Gene ID | 2115 |
mRNA Refseq | NM_001163147 |
Protein Refseq | NP_001156619 |
MIM | 600541 |
Uniprot ID | P50549 |
Chromosome Location | 7p22 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; p38 signaling mediated by MAPKAP kinases, organism-specific biosystem; |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
ETV1-873H | Recombinant Human ETV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV1-28687TH | Recombinant Human ETV1 | +Inquiry |
ETV1-3289Z | Recombinant Zebrafish ETV1 | +Inquiry |
ETV1-1275H | Recombinant Human ETV1 protein, GST-tagged | +Inquiry |
ETV1-6479C | Recombinant Chicken ETV1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV1-6524HCL | Recombinant Human ETV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV1 Products
Required fields are marked with *
My Review for All ETV1 Products
Required fields are marked with *