Recombinant Human EXOSC10 protein(691-850 aa), C-His-tagged
Cat.No. : | EXOSC10-2815H |
Product Overview : | Recombinant Human EXOSC10 protein(Q01780)(691-850 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 691-850 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 19.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGK |
Gene Name | EXOSC10 exosome component 10 [ Homo sapiens ] |
Official Symbol | EXOSC10 |
Synonyms | EXOSC10; exosome component 10; PMSCL2, polymyositis/scleroderma autoantigen 2, 100kDa; p2; p3; p4; PM Scl; PM/Scl 100; polymyositis/scleroderma autoantigen 2 (100kD); RRP6; Rrp6p; autoantigen PM-SCL; autoantigen PM/Scl 2; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2, 100kDa; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL; PM-Scl; PMSCL2; PM/Scl-100; |
Gene ID | 5394 |
mRNA Refseq | NM_001001998 |
Protein Refseq | NP_001001998 |
MIM | 605960 |
UniProt ID | Q01780 |
◆ Recombinant Proteins | ||
EXOSC10-26640TH | Recombinant Human EXOSC10, His-tagged | +Inquiry |
EXOSC10-11312Z | Recombinant Zebrafish EXOSC10 | +Inquiry |
EXOSC10-4426HF | Recombinant Full Length Human EXOSC10 Protein, GST-tagged | +Inquiry |
EXOSC10-5381M | Recombinant Mouse EXOSC10 Protein | +Inquiry |
EXOSC10-3567H | Recombinant Human EXOSC10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOSC10-6504HCL | Recombinant Human EXOSC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC10 Products
Required fields are marked with *
My Review for All EXOSC10 Products
Required fields are marked with *
0
Inquiry Basket