Recombinant Human EXOSC10 protein(691-850 aa), C-His-tagged
| Cat.No. : | EXOSC10-2815H |
| Product Overview : | Recombinant Human EXOSC10 protein(Q01780)(691-850 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 691-850 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 19.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGK |
| Gene Name | EXOSC10 exosome component 10 [ Homo sapiens ] |
| Official Symbol | EXOSC10 |
| Synonyms | EXOSC10; exosome component 10; PMSCL2, polymyositis/scleroderma autoantigen 2, 100kDa; p2; p3; p4; PM Scl; PM/Scl 100; polymyositis/scleroderma autoantigen 2 (100kD); RRP6; Rrp6p; autoantigen PM-SCL; autoantigen PM/Scl 2; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2, 100kDa; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL; PM-Scl; PMSCL2; PM/Scl-100; |
| Gene ID | 5394 |
| mRNA Refseq | NM_001001998 |
| Protein Refseq | NP_001001998 |
| MIM | 605960 |
| UniProt ID | Q01780 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC10 Products
Required fields are marked with *
My Review for All EXOSC10 Products
Required fields are marked with *
