Recombinant Human EXOSC10 protein(691-850 aa), C-His-tagged
| Cat.No. : | EXOSC10-2815H | 
| Product Overview : | Recombinant Human EXOSC10 protein(Q01780)(691-850 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 691-850 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Molecular Mass : | 19.5 kDa | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C.  | 
                                
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | PFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGK | 
| Gene Name | EXOSC10 exosome component 10 [ Homo sapiens ] | 
| Official Symbol | EXOSC10 | 
| Synonyms | EXOSC10; exosome component 10; PMSCL2, polymyositis/scleroderma autoantigen 2, 100kDa; p2; p3; p4; PM Scl; PM/Scl 100; polymyositis/scleroderma autoantigen 2 (100kD); RRP6; Rrp6p; autoantigen PM-SCL; autoantigen PM/Scl 2; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2, 100kDa; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL; PM-Scl; PMSCL2; PM/Scl-100; | 
| Gene ID | 5394 | 
| mRNA Refseq | NM_001001998 | 
| Protein Refseq | NP_001001998 | 
| MIM | 605960 | 
| UniProt ID | Q01780 | 
| ◆ Recombinant Proteins | ||
| EXOSC10-3567H | Recombinant Human EXOSC10 Protein, GST-tagged | +Inquiry | 
| EXOSC10-4426HF | Recombinant Full Length Human EXOSC10 Protein, GST-tagged | +Inquiry | 
| EXOSC10-12594H | Recombinant Human EXOSC10, GST-tagged | +Inquiry | 
| EXOSC10-11312Z | Recombinant Zebrafish EXOSC10 | +Inquiry | 
| EXOSC10-5391H | Recombinant Human EXOSC10 protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EXOSC10-6504HCL | Recombinant Human EXOSC10 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EXOSC10 Products
Required fields are marked with *
My Review for All EXOSC10 Products
Required fields are marked with *
  
        
    
      
            