Recombinant Human EXOSC10 protein(691-850 aa), C-His-tagged

Cat.No. : EXOSC10-2815H
Product Overview : Recombinant Human EXOSC10 protein(Q01780)(691-850 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 691-850 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 19.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGK
Gene Name EXOSC10 exosome component 10 [ Homo sapiens ]
Official Symbol EXOSC10
Synonyms EXOSC10; exosome component 10; PMSCL2, polymyositis/scleroderma autoantigen 2, 100kDa; p2; p3; p4; PM Scl; PM/Scl 100; polymyositis/scleroderma autoantigen 2 (100kD); RRP6; Rrp6p; autoantigen PM-SCL; autoantigen PM/Scl 2; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2, 100kDa; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL; PM-Scl; PMSCL2; PM/Scl-100;
Gene ID 5394
mRNA Refseq NM_001001998
Protein Refseq NP_001001998
MIM 605960
UniProt ID Q01780

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOSC10 Products

Required fields are marked with *

My Review for All EXOSC10 Products

Required fields are marked with *

0
cart-icon
0
compare icon