Recombinant Human EXOSC5, His-tagged
Cat.No. : | EXOSC5-28337TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-235 of Human EXOSC5 with an N terminal His tag. MW 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 6-235 a.a. |
Description : | Exosome component 5, also known as EXOSC5, is a human gene, which is part of the exosome complex. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 96 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSA SFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPK IGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQ VVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDS DGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKG LYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS |
Gene Name | EXOSC5 exosome component 5 [ Homo sapiens ] |
Official Symbol | EXOSC5 |
Synonyms | EXOSC5; exosome component 5; exosome complex component RRP46; exosome component Rrp46; hRrp46p; MGC12901; p12B; RRP41B; RRP46; Rrp46p; |
Gene ID | 56915 |
mRNA Refseq | NM_020158 |
Protein Refseq | NP_064543 |
MIM | 606492 |
Uniprot ID | Q9NQT4 |
Chromosome Location | 19q13.1 |
Pathway | Deadenylation-dependent mRNA decay, organism-specific biosystem; Destabilization of mRNA by Butyrate Response Factor 1 (BRF1), organism-specific biosystem; Destabilization of mRNA by KSRP, organism-specific biosystem; Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Exosome, eukaryotes, organism-specific biosystem; |
Function | 3-5-exoribonuclease activity; RNA binding; NOT exoribonuclease activity; protein binding; |
◆ Recombinant Proteins | ||
Exosc5-2892M | Recombinant Mouse Exosc5 Protein, Myc/DDK-tagged | +Inquiry |
EXOSC5-4330Z | Recombinant Zebrafish EXOSC5 | +Inquiry |
EXOSC5-12598H | Recombinant Human EXOSC5, His-tagged | +Inquiry |
EXOSC5-4431HF | Recombinant Full Length Human EXOSC5 Protein, GST-tagged | +Inquiry |
EXOSC5-28337TH | Recombinant Human EXOSC5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOSC5-6500HCL | Recombinant Human EXOSC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC5 Products
Required fields are marked with *
My Review for All EXOSC5 Products
Required fields are marked with *