Recombinant Human EXOSC5, His-tagged
| Cat.No. : | EXOSC5-28337TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 6-235 of Human EXOSC5 with an N terminal His tag. MW 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 6-235 a.a. |
| Description : | Exosome component 5, also known as EXOSC5, is a human gene, which is part of the exosome complex. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 96 μl distilled water. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | HTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSA SFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPK IGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQ VVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDS DGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKG LYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS |
| Gene Name | EXOSC5 exosome component 5 [ Homo sapiens ] |
| Official Symbol | EXOSC5 |
| Synonyms | EXOSC5; exosome component 5; exosome complex component RRP46; exosome component Rrp46; hRrp46p; MGC12901; p12B; RRP41B; RRP46; Rrp46p; |
| Gene ID | 56915 |
| mRNA Refseq | NM_020158 |
| Protein Refseq | NP_064543 |
| MIM | 606492 |
| Uniprot ID | Q9NQT4 |
| Chromosome Location | 19q13.1 |
| Pathway | Deadenylation-dependent mRNA decay, organism-specific biosystem; Destabilization of mRNA by Butyrate Response Factor 1 (BRF1), organism-specific biosystem; Destabilization of mRNA by KSRP, organism-specific biosystem; Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Exosome, eukaryotes, organism-specific biosystem; |
| Function | 3-5-exoribonuclease activity; RNA binding; NOT exoribonuclease activity; protein binding; |
| ◆ Recombinant Proteins | ||
| EXOSC5-12598H | Recombinant Human EXOSC5, His-tagged | +Inquiry |
| EXOSC5-2903M | Recombinant Mouse EXOSC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EXOSC5-1027H | Recombinant Human EXOSC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EXOSC5-4431HF | Recombinant Full Length Human EXOSC5 Protein, GST-tagged | +Inquiry |
| EXOSC5-0726H | Recombinant Human EXOSC5 Protein (M1-S235), His/Strep tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EXOSC5-6500HCL | Recombinant Human EXOSC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC5 Products
Required fields are marked with *
My Review for All EXOSC5 Products
Required fields are marked with *
