Recombinant Human EZH2 Complex protein, His/Flag-tagged
Cat.No. : | EZH2-163H |
Product Overview : | Mutant version of EZH2 5-member complex, but with a Phe-to-Ile mutation on a.a. 672 of the EZH2 protein.* Complex of human EZH2 (GenBank Accession No. NM_004456), (a.a. 2-end; F672I) with N-terminal His-tag, MW=86 kDa, human EED (NM_003797) (a.a. 2-end) with N-terminal FLAG-tag, MW= 51 kDa, human SUZ12 (NM_015355) (a.a. 2-end) with N-terminal His-tag, MW = 87 kDa, Human AEBP2 (NM_153207) (a.a. 2-end) with N-terminal His-tag, MW= 53 kDa, and human RbAp48 (NM_005610) (a.a. 2-end) with N-terminal His-tag, MW = 48 kDa, co-expressed in a baculovirus expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Flag&His |
Protein Length : | 2–end (all components) |
Form : | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 200 mM imidazole, and 20% glycerol |
Molecular Mass : | 325 kDa (complex) |
AA Sequence : | MHHHHHHGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVH ILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDG TFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKF PSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKY DCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNN SSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAE ASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKK DGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDL CLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYD KYMCSFLINLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADA LKYVGIEREMEIP |
Purity : | ≥ 80% |
Applications : | Useful for Western blot analysis and to investigate protein-protein interactions in the EZH2 complex. |
Storage : | >6 months at -70 centigrade. Avoid freeze/thaw cycles |
Concentration : | 0.6 mg/ml |
Gene Name | EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | EZH2 |
Synonyms | EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169; |
Gene ID | 2146 |
mRNA Refseq | NM_004456 |
Protein Refseq | NP_004447 |
MIM | 601573 |
UniProt ID | Q15910 |
Chromosome Location | 7q35-q36 |
Function | DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding; transferase activity; |
◆ Recombinant Proteins | ||
EZH2-285H | Recombinant Human EZH2 Protein, GST-tagged | +Inquiry |
EZH2-170H | Recombinant Human EZH2 Complex protein, His-tagged | +Inquiry |
EZH2-28H | Recombinant Human EZH2 Protein, MYC/DDK-tagged | +Inquiry |
EZH2-65HFL | Active Recombinant Full Length Human EZH2 Protein, C-Flag-tagged | +Inquiry |
EZH2-48H | Recombinant Human EZH2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZH2-6487HCL | Recombinant Human EZH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EZH2 Products
Required fields are marked with *
My Review for All EZH2 Products
Required fields are marked with *