Recombinant Human EZH2 protein, His-tagged
| Cat.No. : | EZH2-48H |
| Product Overview : | Recombinant Human EZH2 protein(NP_001190176)(158-261 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 158-261 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | EZH2 enhancer of zeste 2 polycomb repressive complex 2 subunit [ Homo sapiens (human) ] |
| Official Symbol | EZH2 |
| Synonyms | WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A |
| Gene ID | 2146 |
| mRNA Refseq | NM_001203247.2 |
| Protein Refseq | NP_001190176 |
| MIM | 601573 |
| UniProt ID | Q15910 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EZH2 Products
Required fields are marked with *
My Review for All EZH2 Products
Required fields are marked with *



