Recombinant Human EZH2 protein, His-tagged
Cat.No. : | EZH2-48H |
Product Overview : | Recombinant Human EZH2 protein(NP_001190176)(158-261 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 158-261 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | EZH2 enhancer of zeste 2 polycomb repressive complex 2 subunit [ Homo sapiens (human) ] |
Official Symbol | EZH2 |
Synonyms | WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A |
Gene ID | 2146 |
mRNA Refseq | NM_001203247.2 |
Protein Refseq | NP_001190176 |
MIM | 601573 |
UniProt ID | Q15910 |
◆ Recombinant Proteins | ||
EZH2-29233TH | Recombinant Human EZH2, His-tagged | +Inquiry |
EZH2-28H | Recombinant Human EZH2 Protein, MYC/DDK-tagged | +Inquiry |
EZH2-46H | Recombinant Human EZH2 Protein, His-tagged | +Inquiry |
EZH2-162H | Recombinant Human EZH2 Complex protein, His/Flag-tagged | +Inquiry |
EZH2-1826H | Recombinant Human EZH2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZH2-6487HCL | Recombinant Human EZH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EZH2 Products
Required fields are marked with *
My Review for All EZH2 Products
Required fields are marked with *