Recombinant Human F3 protein, His-SUMO-tagged
| Cat.No. : | F3-2878H |
| Product Overview : | Recombinant Human F3 protein(P13726)(33-251aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 33-251aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.8 kDa |
| AA Sequence : | SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | F3 coagulation factor III (thromboplastin, tissue factor) [ Homo sapiens ] |
| Official Symbol | F3 |
| Synonyms | F3; coagulation factor III (thromboplastin, tissue factor); tissue factor; CD142; TF; TFA; FLJ17960; |
| Gene ID | 2152 |
| mRNA Refseq | NM_001178096 |
| Protein Refseq | NP_001171567 |
| MIM | 134390 |
| UniProt ID | P13726 |
| ◆ Recombinant Proteins | ||
| F3-459M | Active Recombinant Mouse Coagulation Factor III | +Inquiry |
| F3-2733C | Recombinant Cattle F3 protein, His & T7-tagged | +Inquiry |
| F3-2735R | Active Recombinant Rat F3 protein, His-tagged | +Inquiry |
| F3-883H | Recombinant Human F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| F3-368R | Recombinant Rabbit F3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F3-1691HCL | Recombinant Human F3 cell lysate | +Inquiry |
| F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
| F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F3 Products
Required fields are marked with *
My Review for All F3 Products
Required fields are marked with *
