Recombinant Human FABP12 protein, His-tagged
Cat.No. : | FABP12-3453H |
Product Overview : | Recombinant Human FABP12 protein(1-52 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-52 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | FABP12 fatty acid binding protein 12 [ Homo sapiens ] |
Official Symbol | FABP12 |
Synonyms | FABP12; fatty acid binding protein 12; fatty acid-binding protein 12; LOC646486; fatty acid binding protein ORF; intracellular fatty acid-binding protein FABP12; Probable fatty acid-binding protein ENSP00000353650; |
Gene ID | 646486 |
mRNA Refseq | NM_001105281 |
Protein Refseq | NP_001098751 |
UniProt ID | A6NFH5 |
◆ Recombinant Proteins | ||
FABP12-1360R | Recombinant Rhesus Macaque FABP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP12-1535R | Recombinant Rhesus monkey FABP12 Protein, His-tagged | +Inquiry |
FABP12-6786H | Recombinant Human Fatty Acid Binding Protein 12, His-tagged | +Inquiry |
FABP12-5422M | Recombinant Mouse FABP12 Protein | +Inquiry |
FABP12-1842R | Recombinant Rat FABP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP12 Products
Required fields are marked with *
My Review for All FABP12 Products
Required fields are marked with *