Recombinant Human FABP2 protein

Cat.No. : FABP2-3630H
Product Overview : Recombinant Human FABP2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 131
Description : The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 15.1 kDa, a single non-glycosylated polypeptide chain containing 131 amino acids.
AA Sequence : AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Endotoxin : Less than 0.1 EU/µg of rHuFABP2 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FABP2
Official Symbol FABP2
Synonyms FABP2; fatty acid binding protein 2, intestinal; fatty acid-binding protein, intestinal; I FABP; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein; FABPI; I-FABP; MGC133132;
Gene ID 2169
mRNA Refseq NM_000134
Protein Refseq NP_000125
MIM 134640
UniProt ID P12104

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FABP2 Products

Required fields are marked with *

My Review for All FABP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon