Recombinant Human FABP2 protein
| Cat.No. : | FABP2-3630H |
| Product Overview : | Recombinant Human FABP2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 131 |
| Description : | The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Molecular Mass : | Approximately 15.1 kDa, a single non-glycosylated polypeptide chain containing 131 amino acids. |
| AA Sequence : | AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
| Endotoxin : | Less than 0.1 EU/µg of rHuFABP2 as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | FABP2 |
| Official Symbol | FABP2 |
| Synonyms | FABP2; fatty acid binding protein 2, intestinal; fatty acid-binding protein, intestinal; I FABP; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein; FABPI; I-FABP; MGC133132; |
| Gene ID | 2169 |
| mRNA Refseq | NM_000134 |
| Protein Refseq | NP_000125 |
| MIM | 134640 |
| UniProt ID | P12104 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP2 Products
Required fields are marked with *
My Review for All FABP2 Products
Required fields are marked with *




