Recombinant Human FABP3 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | FABP3-039H |
Product Overview : | FABP3 MS Standard C13 and N15-labeled recombinant protein (NP_004093) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FABP3 fatty acid binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | FABP3 |
Synonyms | FABP3; fatty acid binding protein 3; FABP11; H-FABP; M-FABP; MDGI; O-FABP; fatty acid-binding protein, heart; epididymis secretory sperm binding protein; fatty acid binding protein 11; fatty acid binding protein 3, muscle and heart; heart-type fatty acid-binding protein; mammary-derived growth inhibitor; muscle fatty acid-binding protein |
Gene ID | 2170 |
mRNA Refseq | NM_004102 |
Protein Refseq | NP_004093 |
MIM | 134651 |
UniProt ID | P05413 |
◆ Recombinant Proteins | ||
Fabp3-1005M | Recombinant Mouse Fabp3 Protein, MYC/DDK-tagged | +Inquiry |
FABP3-12632H | Recombinant Human FABP3 protein, GST-tagged | +Inquiry |
Fabp3-1002M | Recombinant Mouse Fabp3 protein | +Inquiry |
FABP3-3634H | Recombinant Human FABP3 Protein, GST-tagged | +Inquiry |
FABP3-3549HFL | Recombinant Full Length Human FABP3 protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-42H | Native Human FABP3 | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP3-6477HCL | Recombinant Human FABP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP3 Products
Required fields are marked with *
My Review for All FABP3 Products
Required fields are marked with *
0
Inquiry Basket