| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | Non | 
                                
                                    | Protein Length : | 127 | 
                                
                                    | Description : | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. | 
                                
                                    | Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose. | 
                                
                                    | Molecular Mass : | Approximately 14.2 kDa, a single non-glycosylated polypeptide chain containing 127 amino acids. | 
                                
                                    | AA Sequence : | AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA | 
                                
                                    | Endotoxin : | Less than 0.1 EU/µg of rHuFABP6 as determined by LAL method. | 
                                
                                    | Purity : | >97% by SDS-PAGE and HPLC analysis. | 
                                
                                    | Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. | 
                                
                                    | Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |