Recombinant Human FABP7 protein, GFP-tagged

• Cat.No.: FABP7-256H
• Product Overview: Recombinant Human FABP7 fused with GFP tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GFP
• Description: The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.
• Form: 50mM Tris-HCl, pH 8.0, 200mM NaCl, 5% Trehalose.
• Molecular Mass: (Theoretical molecular weight)~44kDa
• AA Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYP DHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKSRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNV YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVT AAGITHGMDELYKGGGGSVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTF KNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
• Purity: > 80% as determined by SDS-PAGE
• Storage: Short Term Storage at +4 centigrade, Long Term, please store at -20~-80 centigrade. Avoid freeze/thaw cycles.
• Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 20% glycerol or 0.1% BSA to a concentration of 0.1-1.0mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 centigrade to -70 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FABP7 fatty acid binding protein 7, brain [ Homo sapiens ]
• Official Symbol: FABP7
• Synonyms: FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313
• Gene ID: 2173
• mRNA Refseq: NM_001446
• Protein Refseq: NP_001437
• MIM: 602965
• UniProt ID: O15540
• Chromosome Location: 6q22-q23
• Pathway: PPAR signaling pathway, organism-specific biosystem; PPAR signaling pathway, conserved biosystem
• Function: lipid binding; transporter activity