Recombinant Human FABP7 protein, GFP-tagged

Cat.No. : FABP7-256H
Product Overview : Recombinant Human FABP7 fused with GFP tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GFP
Description : The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.
Form : 50mM Tris-HCl, pH 8.0, 200mM NaCl, 5% Trehalose.
Molecular Mass : (Theoretical molecular weight)~44kDa
AA Sequence : MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYP DHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKSRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNV YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVT AAGITHGMDELYKGGGGSVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTF KNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Purity : > 80% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Reconstitution : Reconstitute in sterile distilled water or aqueous buffer containing 20% glycerol or 0.1% BSA to a concentration of 0.1-1.0mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 centigrade to -70 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FABP7 fatty acid binding protein 7, brain [ Homo sapiens ]
Official Symbol FABP7
Synonyms FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313;
Gene ID 2173
mRNA Refseq NM_001446
Protein Refseq NP_001437
MIM 602965
UniProt ID O15540
Chromosome Location 6q22-q23
Pathway PPAR signaling pathway, organism-specific biosystem; PPAR signaling pathway, conserved biosystem;
Function lipid binding; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FABP7 Products

Required fields are marked with *

My Review for All FABP7 Products

Required fields are marked with *

0
cart-icon