Recombinant Human FABP7 protein, GFP-tagged FABP7-256H

Recombinant Human FABP7 protein, GFP-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FABP7 protein, GFP-tagged

Recombinant Human FABP7 protein, GFP-tagged

FABP7 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FABP7-256H
Product Overview : Recombinant Human FABP7 fused with GFP tag was expressed in E. coli.
Description : The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.
Source : E. coli
Species : Human
Tag : GFP
Form : 50mM Tris-HCl, pH 8.0, 200mM NaCl, 5% Trehalose.
Molecular Mass : (Theoretical molecular weight)~44kDa
AA Sequence : MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYP DHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKSRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNV YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVT AAGITHGMDELYKGGGGSVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTF KNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Purity : > 80% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Reconstitution : Reconstitute in sterile distilled water or aqueous buffer containing 20% glycerol or 0.1% BSA to a concentration of 0.1-1.0mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 centigrade to -70 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : FABP7 fatty acid binding protein 7, brain [ Homo sapiens ]
Official Symbol : FABP7
Synonyms : FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313;
Gene ID : 2173
mRNA Refseq : NM_001446
Protein Refseq : NP_001437
MIM : 602965
UniProt ID : O15540
Chromosome Location : 6q22-q23
Pathway : PPAR signaling pathway, organism-specific biosystem; PPAR signaling pathway, conserved biosystem;
Function : lipid binding; transporter activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy