Recombinant Human FABP7 Protein, GFP-tagged
Cat.No. : | FABP7-02H |
Product Overview : | Recombinant Human FABP7 Protein, fused to GFP-tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GFP |
Description : | The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. |
Form : | 50mMTris-HCl, pH 8.0, 200mMNaCl, 5%Trehalose. |
Molecular Mass : | 44kDa |
AA Sequence : | MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKSRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAAGITHGMDELYKGGGGSVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Purity : | > 80% as determined by SDS-PAGE |
Storage : | Short Term Storage at 4 centigrade, Long Term, please store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 20% glycerol or 0.1% BSA to a concentration of 0.1-1.0mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 centigrade to -70 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FABP7 fatty acid binding protein 7 [ Homo sapiens (human) ] |
Official Symbol | FABP7 |
Synonyms | MRG; BLBP; FABPB; B-FABP |
Gene ID | 2173 |
mRNA Refseq | NM_001446.5 |
Protein Refseq | NP_001437.1 |
MIM | 602965 |
UniProt ID | O15540 |
◆ Recombinant Proteins | ||
FABP7-1847R | Recombinant Rat FABP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP7-01H | Recombinant Human FABP7 protein, His-tagged | +Inquiry |
FABP7-4349H | Recombinant Human Fatty Acid Binding Protein-7, His-tagged | +Inquiry |
Fabp7-712M | Recombinant Mouse Fabp7 Protein, MYC/DDK-tagged | +Inquiry |
FABP7-370H | Recombinant Human FABP7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP7-6474HCL | Recombinant Human FABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP7 Products
Required fields are marked with *
My Review for All FABP7 Products
Required fields are marked with *
0
Inquiry Basket