| Species : |
Human |
| Source : |
E.coli |
| Tag : |
GFP |
| Description : |
The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. |
| Form : |
50mMTris-HCl, pH 8.0, 200mMNaCl, 5%Trehalose. |
| Molecular Mass : |
44kDa |
| AA Sequence : |
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKSRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAAGITHGMDELYKGGGGSVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
| Purity : |
> 80% as determined by SDS-PAGE |
| Storage : |
Short Term Storage at 4 centigrade, Long Term, please store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Reconstitution : |
Reconstitute in sterile distilled water or aqueous buffer containing 20% glycerol or 0.1% BSA to a concentration of 0.1-1.0mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 centigrade to -70 centigrade. Further dilutions should be made in appropriate buffered solutions. |
