Recombinant Human FABP7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FABP7-1341H |
Product Overview : | FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FABP7 fatty acid binding protein 7 [ Homo sapiens (human) ] |
Official Symbol | FABP7 |
Synonyms | FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313; |
Gene ID | 2173 |
mRNA Refseq | NM_001446 |
Protein Refseq | NP_001437 |
MIM | 602965 |
UniProt ID | O15540 |
◆ Recombinant Proteins | ||
Fabp7-712M | Recombinant Mouse Fabp7 Protein, MYC/DDK-tagged | +Inquiry |
FABP7-3638H | Recombinant Human FABP7 Protein, GST-tagged | +Inquiry |
FABP7-26319TH | Recombinant Human FABP7 | +Inquiry |
FABP7-300H | Recombinant Human Fatty Acid Binding Protein 7 | +Inquiry |
FABP7-1341H | Recombinant Human FABP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP7-6474HCL | Recombinant Human FABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP7 Products
Required fields are marked with *
My Review for All FABP7 Products
Required fields are marked with *