Recombinant Human FADS2 protein, GST-tagged
Cat.No. : | FADS2-3695H |
Product Overview : | Recombinant Human FADS2 protein(1-124 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-124 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FADS2 fatty acid desaturase 2 [ Homo sapiens ] |
Official Symbol | FADS2 |
Synonyms | FADS2; fatty acid desaturase 2; LLCDL2; D6D; delta 6 desaturase; DES6; FADSD6; SLL0262; TU13; delta-6 desaturase; delta-6-desaturase; delta(6) desaturase; delta-6 fatty acid desaturase; delta(6) fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 2; |
Gene ID | 9415 |
mRNA Refseq | NM_004265 |
Protein Refseq | NP_004256 |
MIM | 606149 |
UniProt ID | O95864 |
◆ Recombinant Proteins | ||
FADS2-4436HF | Recombinant Full Length Human FADS2 Protein, GST-tagged | +Inquiry |
FADS2-5432M | Recombinant Mouse FADS2 Protein | +Inquiry |
Fads2-2905M | Recombinant Mouse Fads2 Protein, Myc/DDK-tagged | +Inquiry |
RFL35855XF | Recombinant Full Length Xenopus Laevis Fatty Acid Desaturase 2(Fads2) Protein, His-Tagged | +Inquiry |
FADS2-1850R | Recombinant Rat FADS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS2 Products
Required fields are marked with *
My Review for All FADS2 Products
Required fields are marked with *