Recombinant Human FADS3 protein, GST-tagged

• Cat.No.: FADS3-1807H
• Product Overview: Recombinant Human FADS3 protein(1-130 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-130 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: FADS3 fatty acid desaturase 3 [ Homo sapiens ]
• Official Symbol: FADS3
• Synonyms: FADS3; fatty acid desaturase 3; LLCDL3; CYB5RP; delta 9 desaturase; delta-9-desaturase; cytochrome b5-related protein; delta-9 fatty acid desaturase; linoleoyl-CoA desaturase (delta-9-desaturase)-like 3
• Gene ID: 3995
• mRNA Refseq: NM_021727
• Protein Refseq: NP_068373
• MIM: 606150
• UniProt ID: Q9Y5Q0