Recombinant Human FADS3 protein, GST-tagged
Cat.No. : | FADS3-1807H |
Product Overview : | Recombinant Human FADS3 protein(1-130 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-130 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FADS3 fatty acid desaturase 3 [ Homo sapiens ] |
Official Symbol | FADS3 |
Synonyms | FADS3; fatty acid desaturase 3; LLCDL3; CYB5RP; delta 9 desaturase; delta-9-desaturase; cytochrome b5-related protein; delta-9 fatty acid desaturase; linoleoyl-CoA desaturase (delta-9-desaturase)-like 3; |
Gene ID | 3995 |
mRNA Refseq | NM_021727 |
Protein Refseq | NP_068373 |
MIM | 606150 |
UniProt ID | Q9Y5Q0 |
◆ Recombinant Proteins | ||
RFL6588RF | Recombinant Full Length Rat Fatty Acid Desaturase 3(Fads3) Protein, His-Tagged | +Inquiry |
FADS3-1807H | Recombinant Human FADS3 protein, GST-tagged | +Inquiry |
FADS3-1851R | Recombinant Rat FADS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FADS3-3605H | Recombinant Human FADS3 Protein (Glu331-Gln445), His tagged | +Inquiry |
FADS3-28818TH | Recombinant Human FADS3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADS3-6471HCL | Recombinant Human FADS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS3 Products
Required fields are marked with *
My Review for All FADS3 Products
Required fields are marked with *