Recombinant Human FADS3 protein, GST-tagged

Cat.No. : FADS3-1807H
Product Overview : Recombinant Human FADS3 protein(1-130 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability August 20, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-130 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name FADS3 fatty acid desaturase 3 [ Homo sapiens ]
Official Symbol FADS3
Synonyms FADS3; fatty acid desaturase 3; LLCDL3; CYB5RP; delta 9 desaturase; delta-9-desaturase; cytochrome b5-related protein; delta-9 fatty acid desaturase; linoleoyl-CoA desaturase (delta-9-desaturase)-like 3;
Gene ID 3995
mRNA Refseq NM_021727
Protein Refseq NP_068373
MIM 606150
UniProt ID Q9Y5Q0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FADS3 Products

Required fields are marked with *

My Review for All FADS3 Products

Required fields are marked with *

0
cart-icon
0
compare icon