Recombinant Human FAF1 protein, GST-tagged
| Cat.No. : | FAF1-30137H | 
| Product Overview : | Recombinant Human FAF1 (268-489 aa) protein, fused to GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | Arg268-Ala489 | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| AA Sequence : | RSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTA | 
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | FAF1 Fas (TNFRSF6) associated factor 1 [ Homo sapiens ] | 
| Official Symbol | FAF1 | 
| Synonyms | FAF1; Fas (TNFRSF6) associated factor 1; FAS-associated factor 1; CGI 03; hFAF1; HFAF1s; TNFRSF6 associated factor 1; UBX domain protein 3A; UBXD12; UBXN3A; TNFRSF6-associated factor 1; UBX domain-containing protein 12; UBX domain-containing protein 3A; CGI-03; FLJ37524; | 
| Gene ID | 11124 | 
| mRNA Refseq | NM_007051 | 
| Protein Refseq | NP_008982 | 
| MIM | 604460 | 
| UniProt ID | Q9UNN5 | 
| ◆ Recombinant Proteins | ||
| FAF1-2936M | Recombinant Mouse FAF1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FAF1-3647H | Recombinant Human FAF1 Protein, GST-tagged | +Inquiry | 
| FAF1-5435M | Recombinant Mouse FAF1 Protein | +Inquiry | 
| FAF1-886H | Recombinant Human FAF1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FAF1-1541R | Recombinant Rhesus monkey FAF1 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FAF1-6470HCL | Recombinant Human FAF1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAF1 Products
Required fields are marked with *
My Review for All FAF1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            