Recombinant Human FAHD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FAHD1-960H |
| Product Overview : | FAHD1 MS Standard C13 and N15-labeled recombinant protein (NP_112485) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Metabolism and Tyrosine metabolism. Gene Ontology (GO) annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A. |
| Molecular Mass : | 24.7 kDa |
| AA Sequence : | MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKPEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | FAHD1 |
| Synonyms | FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046; |
| Gene ID | 81889 |
| mRNA Refseq | NM_031208 |
| Protein Refseq | NP_112485 |
| MIM | 616320 |
| UniProt ID | Q6P587 |
| ◆ Recombinant Proteins | ||
| FAHD1-2198R | Recombinant Rat FAHD1 Protein | +Inquiry |
| FAHD1-5116C | Recombinant Chicken FAHD1 | +Inquiry |
| FAHD1-4439HF | Recombinant Full Length Human FAHD1 Protein, GST-tagged | +Inquiry |
| FAHD1-2873Z | Recombinant Zebrafish FAHD1 | +Inquiry |
| FAHD1-958H | Recombinant Human FAHD1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAHD1-250HCL | Recombinant Human FAHD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAHD1 Products
Required fields are marked with *
My Review for All FAHD1 Products
Required fields are marked with *
