Recombinant Human FAM103A1 Protein, GST-tagged

Cat.No. : FAM103A1-3664H
Product Overview : Human FAM103A1 full-length ORF (1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM103A1 (Family With Sequence Similarity 103 Member A1) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and RNA binding.
Molecular Mass : 39.38 kDa
AA Sequence : MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM103A1 family with sequence similarity 103, member A1 [ Homo sapiens ]
Official Symbol FAM103A1
Synonyms RAM; C15orf18; HsT19360; FAM103A1; family with sequence similarity 103, member A1
Gene ID 83640
mRNA Refseq NM_031452
Protein Refseq NP_113640
MIM 614547
UniProt ID Q9BTL3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM103A1 Products

Required fields are marked with *

My Review for All FAM103A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon