Recombinant Human FAM107B Protein, GST-tagged

Cat.No. : FAM107B-3668H
Product Overview : Human FAM107B full-length ORF ( ENSP00000367731, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM107B (Family With Sequence Similarity 107 Member B) is a Protein Coding gene. An important paralog of this gene is FAM107A.
Molecular Mass : 42 kDa
AA Sequence : MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM107B family with sequence similarity 107, member B [ Homo sapiens ]
Official Symbol FAM107B
Synonyms C10orf45; FAM107B; family with sequence similarity 107, member B; Family With Sequence Similarity 107 Member B; Heat Shock-Inducible Tumor Small Protein; Family With Sequence Similarity 107, Member B; Chromosome 10 Open Reading Frame 45; Protein FAM107B; HITS
Gene ID 83641
mRNA Refseq NM_031453
Protein Refseq NP_113641
UniProt ID Q9H098

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM107B Products

Required fields are marked with *

My Review for All FAM107B Products

Required fields are marked with *

0
cart-icon
0
compare icon