Recombinant Human FAM122A Protein, GST-tagged
| Cat.No. : | FAM122A-3689H |
| Product Overview : | Human FAM122A full-length ORF ( NP_612206.3, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM122A (Family With Sequence Similarity 122A) is a Protein Coding gene. An important paralog of this gene is FAM122B. |
| Molecular Mass : | 56.9 kDa |
| AA Sequence : | MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM122A family with sequence similarity 122A [ Homo sapiens ] |
| Official Symbol | FAM122A |
| Synonyms | FAM122A; family with sequence similarity 122A; C9orf42, chromosome 9 open reading frame 42; protein FAM122A; MGC17347; C9orf42; |
| Gene ID | 116224 |
| mRNA Refseq | NM_138333 |
| Protein Refseq | NP_612206 |
| MIM | 617249 |
| UniProt ID | Q96E09 |
| ◆ Recombinant Proteins | ||
| FAM122A-2971M | Recombinant Mouse FAM122A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fam122a-2913M | Recombinant Mouse Fam122a Protein, Myc/DDK-tagged | +Inquiry |
| FAM122A-2213R | Recombinant Rat FAM122A Protein | +Inquiry |
| FAM122A-1128H | Recombinant Human FAM122A Protein, MYC/DDK-tagged | +Inquiry |
| FAM122A-3689H | Recombinant Human FAM122A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM122A-583HCL | Recombinant Human FAM122A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM122A Products
Required fields are marked with *
My Review for All FAM122A Products
Required fields are marked with *




