Recombinant Human FAM122A Protein, GST-tagged

• Cat.No.: FAM122A-3689H
• Product Overview: Human FAM122A full-length ORF ( NP_612206.3, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM122A (Family With Sequence Similarity 122A) is a Protein Coding gene. An important paralog of this gene is FAM122B.
• Molecular Mass: 56.9 kDa
• AA Sequence: MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM122A family with sequence similarity 122A [ Homo sapiens ]
• Official Symbol: FAM122A
• Synonyms: FAM122A; family with sequence similarity 122A; C9orf42, chromosome 9 open reading frame 42; protein FAM122A; MGC17347; C9orf42
• Gene ID: 116224
• mRNA Refseq: NM_138333
• Protein Refseq: NP_612206
• MIM: 617249
• UniProt ID: Q96E09