Recombinant Human FAM126B Protein, GST-tagged
Cat.No. : | FAM126B-3696H |
Product Overview : | Human FAM126B full-length ORF ( NP_776183.1, 1 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM126B (Family With Sequence Similarity 126 Member B) is a Protein Coding gene. An important paralog of this gene is FAM126A. |
Molecular Mass : | 85 kDa |
AA Sequence : | MLGTDRCVVEEWLSEFKALPDTQITSYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELMWVYLRLTVSRDRQSNGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKHWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSSQRGSLRKVATGRSAKDKETASAIKSSESPRDSVVRKQYVQQPTDLSVDSVELTPMKKHLSLPAGQVVPKINSLSLIRTASASSSKSFDYVNGSQASTSIGVGTEGGTNLAANNANRYSTVSLQEDRLGQAGEGKELLSPGAPLTKQSRSPSFNMQLISQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM126B family with sequence similarity 126, member B [ Homo sapiens ] |
Official Symbol | FAM126B |
Synonyms | HYCC2; FAM126B; family with sequence similarity 126, member B |
Gene ID | 285172 |
mRNA Refseq | NM_173822 |
Protein Refseq | NP_776183 |
UniProt ID | Q8IXS8 |
◆ Recombinant Proteins | ||
FAM126B-1389R | Recombinant Rhesus Macaque FAM126B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM126B-5486M | Recombinant Mouse FAM126B Protein | +Inquiry |
FAM126B-4522HF | Recombinant Full Length Human FAM126B Protein, GST-tagged | +Inquiry |
FAM126B-3696H | Recombinant Human FAM126B Protein, GST-tagged | +Inquiry |
FAM126B-1564R | Recombinant Rhesus monkey FAM126B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM126B-6435HCL | Recombinant Human FAM126B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM126B Products
Required fields are marked with *
My Review for All FAM126B Products
Required fields are marked with *