Recombinant Human FAM181A Protein, GST-tagged
| Cat.No. : | FAM181A-3725H | 
| Product Overview : | Human FAM181A full-length ORF ( AAH09073.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | FAM181A (Family With Sequence Similarity 181 Member A) is a Protein Coding gene. | 
| Molecular Mass : | 58.5 kDa | 
| AA Sequence : | MASDSDVKMLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRRLLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHSYHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNVFGYL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FAM181A family with sequence similarity 181, member A [ Homo sapiens ] | 
| Official Symbol | FAM181A | 
| Synonyms | C14orf152; FAM181A; family with sequence similarity 181, member A; Family With Sequence Similarity 181 Member A; Family With Sequence Similarity 181, Member A; Chromosome 14 Open Reading Frame 152; Protein FAM181A | 
| Gene ID | 90050 | 
| mRNA Refseq | NM_138344 | 
| Protein Refseq | NP_612353 | 
| UniProt ID | Q8N9Y4 | 
| ◆ Recombinant Proteins | ||
| FAM181A-4538HF | Recombinant Full Length Human FAM181A Protein, GST-tagged | +Inquiry | 
| FAM181A-3725H | Recombinant Human FAM181A Protein, GST-tagged | +Inquiry | 
| FAM181A-1296H | Recombinant Human FAM181A Protein, His-tagged | +Inquiry | 
| FAM181A-2724H | Recombinant Human FAM181A protein, His-tagged | +Inquiry | 
| FAM181A-1449H | Recombinant Human FAM181A | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FAM181A-264HCL | Recombinant Human FAM181A lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM181A Products
Required fields are marked with *
My Review for All FAM181A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            