Recombinant Human FAM19A1 Protein, His tagged
| Cat.No. : | FAM19A1-001H |
| Product Overview : | Recombinant Human FAM19A1 Protein (26-133 aa) with His tag was expressed in E. coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 26-133 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose |
| AA Sequence : | MSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRTHHHHHHHH |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Concentration : | 1 mg/mL by BCA |
| Official Symbol | TAFA1 |
| Synonyms | TAFA1; TAFA chemokine like family member 1; TAFA-1; FAM19A1; chemokine-like protein TAFA-1; family with sequence similarity 19 (chemokine (C-C motif)-like), member A1; family with sequence similarity 19 member A1, C-C motif chemokine like; protein FAM19A1 |
| Gene ID | 407738 |
| mRNA Refseq | NM_213609 |
| Protein Refseq | NP_998774 |
| MIM | 617495 |
| UniProt ID | Q7Z5A9 |
| ◆ Recombinant Proteins | ||
| FAM19A1-001H | Recombinant Human FAM19A1 Protein, His tagged | +Inquiry |
| FAM19A1-3042M | Recombinant Mouse FAM19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM19A1-1600R | Recombinant Rhesus monkey FAM19A1 Protein, His-tagged | +Inquiry |
| FAM19A1-884H | Active Recombinant Human FAM19A1 | +Inquiry |
| FAM19A1-5571M | Recombinant Mouse FAM19A1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM19A1-6389HCL | Recombinant Human FAM19A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM19A1 Products
Required fields are marked with *
My Review for All FAM19A1 Products
Required fields are marked with *
