Recombinant Human FAM19A1 Protein, His tagged

• Cat.No.: FAM19A1-001H
• Product Overview: Recombinant Human FAM19A1 Protein (26-133 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 26-133 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose
• AA Sequence: MSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRTHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Concentration: 1 mg/mL by BCA

Gene Information

• Official Symbol: TAFA1
• Synonyms: TAFA1; TAFA chemokine like family member 1; TAFA-1; FAM19A1; chemokine-like protein TAFA-1; family with sequence similarity 19 (chemokine (C-C motif)-like), member A1; family with sequence similarity 19 member A1, C-C motif chemokine like; protein FAM19A1
• Gene ID: 407738
• mRNA Refseq: NM_213609
• Protein Refseq: NP_998774
• MIM: 617495
• UniProt ID: Q7Z5A9