Recombinant Human FAM19A1 Protein, His tagged

Cat.No. : FAM19A1-001H
Product Overview : Recombinant Human FAM19A1 Protein (26-133 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 26-133 aa
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose
AA Sequence : MSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRTHHHHHHHH
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Concentration : 1 mg/mL by BCA
Official Symbol TAFA1
Synonyms TAFA1; TAFA chemokine like family member 1; TAFA-1; FAM19A1; chemokine-like protein TAFA-1; family with sequence similarity 19 (chemokine (C-C motif)-like), member A1; family with sequence similarity 19 member A1, C-C motif chemokine like; protein FAM19A1
Gene ID 407738
mRNA Refseq NM_213609
Protein Refseq NP_998774
MIM 617495
UniProt ID Q7Z5A9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM19A1 Products

Required fields are marked with *

My Review for All FAM19A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon