Recombinant Human FAM19A1 Protein, His tagged
Cat.No. : | FAM19A1-001H |
Product Overview : | Recombinant Human FAM19A1 Protein (26-133 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 26-133 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose |
AA Sequence : | MSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRTHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Concentration : | 1 mg/mL by BCA |
Official Symbol | TAFA1 |
Synonyms | TAFA1; TAFA chemokine like family member 1; TAFA-1; FAM19A1; chemokine-like protein TAFA-1; family with sequence similarity 19 (chemokine (C-C motif)-like), member A1; family with sequence similarity 19 member A1, C-C motif chemokine like; protein FAM19A1 |
Gene ID | 407738 |
mRNA Refseq | NM_213609 |
Protein Refseq | NP_998774 |
MIM | 617495 |
UniProt ID | Q7Z5A9 |
◆ Recombinant Proteins | ||
FAM19A1-884H | Active Recombinant Human FAM19A1 | +Inquiry |
FAM19A1-504C | Recombinant Cynomolgus FAM19A1 Protein, His-tagged | +Inquiry |
FAM19A1-3042M | Recombinant Mouse FAM19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM19A1-1424R | Recombinant Rhesus Macaque FAM19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM19A1-249C | Recombinant Cynomolgus Monkey FAM19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FAM19A1-001H | Recombinant Human FAM19A1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A1-6389HCL | Recombinant Human FAM19A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM19A1 Products
Required fields are marked with *
My Review for All FAM19A1 Products
Required fields are marked with *
0
Inquiry Basket