Recombinant Human FAM19A4 Protein, GST-tagged
| Cat.No. : | FAM19A4-3732H |
| Product Overview : | Human FAM19A4 full-length ORF ( NP_001005527.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Nov 2011] |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM19A4 family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 [ Homo sapiens ] |
| Official Symbol | FAM19A4 |
| Synonyms | FAM19A4; family with sequence similarity 19 (chemokine (C-C motif)-like), member A4; protein FAM19A4; TAFA 4; chemokine-like protein TAFA-4; TAFA4; TAFA-4; FLJ25161; |
| Gene ID | 151647 |
| mRNA Refseq | NM_001005527 |
| Protein Refseq | NP_001005527 |
| MIM | 617498 |
| UniProt ID | Q96LR4 |
| ◆ Recombinant Proteins | ||
| FAM19A4-279H | Recombinant Human FAM19A4, Fc-tagged | +Inquiry |
| FAM19A4-164H | Recombinant Human FAM19A4 Protein, HIS-tagged | +Inquiry |
| FAM19A4-1289H | Recombinant Human FAM19A4 Protein, MYC/DDK-tagged | +Inquiry |
| FAM19A4-5574M | Recombinant Mouse FAM19A4 Protein | +Inquiry |
| FAM19A4-505C | Recombinant Cynomolgus FAM19A4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM19A4-001HCL | Recombinant Human FAM19A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM19A4 Products
Required fields are marked with *
My Review for All FAM19A4 Products
Required fields are marked with *



