Recombinant Human FAM19A4 Protein, GST-tagged

Cat.No. : FAM19A4-3732H
Product Overview : Human FAM19A4 full-length ORF ( NP_001005527.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Nov 2011]
Molecular Mass : 42.1 kDa
AA Sequence : MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM19A4 family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 [ Homo sapiens ]
Official Symbol FAM19A4
Synonyms FAM19A4; family with sequence similarity 19 (chemokine (C-C motif)-like), member A4; protein FAM19A4; TAFA 4; chemokine-like protein TAFA-4; TAFA4; TAFA-4; FLJ25161;
Gene ID 151647
mRNA Refseq NM_001005527
Protein Refseq NP_001005527
MIM 617498
UniProt ID Q96LR4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM19A4 Products

Required fields are marked with *

My Review for All FAM19A4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon