Recombinant Human FAM204A Protein, GST-tagged

Cat.No. : FAM204A-3734H
Product Overview : Human FAM204A full-length ORF ( NP_071346.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM204A (Family With Sequence Similarity 204 Member A) is a Protein Coding gene.
Molecular Mass : 53.4 kDa
AA Sequence : MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPIDMWNKFQELHKKHSEQKSTTSRFRGKRRKRSRKDKLKNEKELHSEPSSNETQWKELTQYFGVNDRFDPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQLATRELGVKIAKAVACHNFVKAKKEVENSQAARKKKKLAWGFEAKKRWETKSNMGYM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM204A family with sequence similarity 204, member A [ Homo sapiens ]
Official Symbol FAM204A
Synonyms C10orf84; bA319I23.1; RP11-319I23.1; FAM204A; family with sequence similarity 204, member A; Family With Sequence Similarity 204 Member A; Family With Sequence Similarity 204, Member A; Chromosome 10 Open Reading Frame 84; Protein FAM204A; BA319I23.1
Gene ID 63877
mRNA Refseq NM_022063
Protein Refseq NP_071346
UniProt ID Q9H8W3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM204A Products

Required fields are marked with *

My Review for All FAM204A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon