Recombinant Human FAM206A Protein, GST-tagged

Cat.No. : FAM206A-4260H
Product Overview : Human FLJ20457 full-length ORF ( AAH15795, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM206A (Family With Sequence Similarity 206 Member A) is a Protein Coding gene. Diseases associated with FAM206A include Peroxisome Biogenesis Disorder 1B.
Molecular Mass : 45.65 kDa
AA Sequence : MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM206A family with sequence similarity 206 member A [ Homo sapiens (human) ]
Official Symbol FAM206A
Synonyms FAM206A; family with sequence similarity 206 member A; CG-8; C9orf6; Simiate; protein Simiate; protein FAM206A
Gene ID 54942
mRNA Refseq NM_017832
Protein Refseq NP_060302
UniProt ID Q9NX38

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM206A Products

Required fields are marked with *

My Review for All FAM206A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon