Recombinant Full Length Human FAM206A Protein, GST-tagged
Cat.No. : | FAM206A-4890HF |
Product Overview : | Human FLJ20457 full-length ORF ( AAH15795, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 181 amino acids |
Description : | FAM206A (Family With Sequence Similarity 206 Member A) is a Protein Coding gene. Diseases associated with FAM206A include Peroxisome Biogenesis Disorder 1B. |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM206A family with sequence similarity 206 member A [ Homo sapiens (human) ] |
Official Symbol | FAM206A |
Synonyms | FAM206A; family with sequence similarity 206 member A; CG-8; C9orf6; Simiate; protein Simiate; protein FAM206A |
Gene ID | 54942 |
mRNA Refseq | NM_017832 |
Protein Refseq | NP_060302 |
UniProt ID | Q9NX38 |
◆ Recombinant Proteins | ||
FAM206A-4030Z | Recombinant Zebrafish FAM206A | +Inquiry |
FAM206A-1425R | Recombinant Rhesus Macaque FAM206A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM206A-1601R | Recombinant Rhesus monkey FAM206A Protein, His-tagged | +Inquiry |
FAM206A-1525C | Recombinant Chicken FAM206A | +Inquiry |
FAM206A-4260H | Recombinant Human FAM206A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM206A-7927HCL | Recombinant Human C9orf6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM206A Products
Required fields are marked with *
My Review for All FAM206A Products
Required fields are marked with *
0
Inquiry Basket