"FAM20A" Related Products

Expand

Recombinant Human FAM20A protein, His-tagged

Cat.No.: FAM20A-11H
Product Overview: Recombinant Human FAM20A(34-541aa) fused with His tag was expressed in Yeast.
Source: Yeast
Species: Human
Tag: His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 59.6kD
Protein length: 34-541aa
AA Sequence: QLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHNFSRTEPRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPP LLGAEDSLLASQEALRYYRRKVARWNRRHKMYREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSK LLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQ RHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVTKNEILQSVFFVSPASNVCFFAKCPYMCKTEYAVCGNP HLLEGSLSAFLPSLNLAPRLSVPNPWIRSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGN MDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLE DQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQLAPDSGQANLTS
Purity: >90% ( SDS-PAGE )
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name: FAM20A family with sequence similarity 20, member A [ Homo sapiens ]
Official Symbol: FAM20A
Synonyms: FAM20A; family with sequence similarity 20, member A; protein FAM20A; DKFZp434F2322; AIGFS; FP2747;
Gene ID: 54757
mRNA Refseq: NM_001243746
Protein Refseq: NP_001230675
MIM: 611062
UniProt ID: Q96MK3
Chromosome Location: 17q24.3

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.