Recombinant Full Length Human FAM20A Protein, GST-tagged
Cat.No. : | FAM20A-6923HF |
Product Overview : | Recombinant Human full-length FAM20A(1 a.a. - 541 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 541 amino acids |
Description : | This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation at this locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified. |
Molecular Mass : | 87.8 kDa |
AA Sequence : | MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHNFSRTE PRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLGAEDSLLASQEALRYYRRKVARWNRRHKMYREQMNLTSLD PPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLV LRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVTKNEI LQSVFFVSPASNVCFFAKCPYMCKTEYAVCGKPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYTLAGKEEWEVNP LYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLS QCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDG PVEQSAPDSGQANLTS |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM20A family with sequence similarity 20, member A [ Homo sapiens ] |
Official Symbol | FAM20A |
Synonyms | FAM20A; family with sequence similarity 20, member A; protein FAM20A; DKFZp434F2322; AIGFS; FP2747; AI1G |
Gene ID | 54757 |
mRNA Refseq | NM_001243746 |
Protein Refseq | NP_001230675 |
MIM | 611062 |
UniProt ID | Q96MK3 |
◆ Recombinant Proteins | ||
FAM20A-10H | Recombinant Human FAM20A protein, His/T7-tagged | +Inquiry |
FAM20A-162H | Recombinant Human FAM20A, GST-tagged | +Inquiry |
FAM20A-11H | Recombinant Human FAM20A protein, His-tagged | +Inquiry |
FAM20A-6923HF | Recombinant Full Length Human FAM20A Protein, GST-tagged | +Inquiry |
FAM20A-7136Z | Recombinant Zebrafish FAM20A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM20A Products
Required fields are marked with *
My Review for All FAM20A Products
Required fields are marked with *
0
Inquiry Basket