Recombinant Human FAM216B Protein, GST-tagged

Cat.No. : FAM216B-3741H
Product Overview : Human FAM216B full-length ORF ( ADR82823.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM216B (Family With Sequence Similarity 216 Member B) is a Protein Coding gene.
Molecular Mass : 15.3 kDa
AA Sequence : MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM216B family with sequence similarity 216, member B [ Homo sapiens ]
Official Symbol FAM216B
Synonyms C13orf30; FAM216B; family with sequence similarity 216, member B; Family With Sequence Similarity 216 Member B; Family With Sequence Similarity 216, Member B; Chromosome 13 Open Reading Frame 30; Protein FAM216B
Gene ID 144809
mRNA Refseq NM_182508
Protein Refseq NP_872314
UniProt ID Q8N7L0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM216B Products

Required fields are marked with *

My Review for All FAM216B Products

Required fields are marked with *

0
cart-icon
0
compare icon