Recombinant Human FAM32A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM32A-3202H |
Product Overview : | FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli. |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM32A family with sequence similarity 32 member A [ Homo sapiens (human) ] |
Official Symbol | FAM32A |
Synonyms | FAM32A; family with sequence similarity 32, member A; protein FAM32A; DKFZP586O0120; ovarian tumor associated gene-12; OTAG12; |
Gene ID | 26017 |
mRNA Refseq | NM_014077 |
Protein Refseq | NP_054796 |
MIM | 614554 |
UniProt ID | Q9Y421 |
◆ Recombinant Proteins | ||
FAM32A-4575HF | Recombinant Full Length Human FAM32A Protein, GST-tagged | +Inquiry |
FAM32A-360H | Recombinant Human FAM32A Protein, MYC/DDK-tagged | +Inquiry |
FAM32A-1903R | Recombinant Rat FAM32A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM32A-2246R | Recombinant Rat FAM32A Protein | +Inquiry |
FAM32A-12698H | Recombinant Human FAM32A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM32A-6384HCL | Recombinant Human FAM32A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM32A Products
Required fields are marked with *
My Review for All FAM32A Products
Required fields are marked with *
0
Inquiry Basket