Recombinant Human FAM3D Protein, His-tagged
Cat.No. : | FAM3D-365H |
Product Overview : | Recombinant Human FAM3D fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 23.12 kDa |
AA Sequence : | YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | FAM3D family with sequence similarity 3, member D [ Homo sapiens ] |
Official Symbol | FAM3D |
Synonyms | FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7; |
Gene ID | 131177 |
mRNA Refseq | NM_138805 |
Protein Refseq | NP_620160 |
MIM | 608619 |
UniProt ID | Q96BQ1 |
◆ Recombinant Proteins | ||
FAM3D-3663H | Recombinant Human FAM3D Protein (Tyr26-Phe224), C-His tagged | +Inquiry |
FAM3D-3756H | Recombinant Human FAM3D Protein, GST-tagged | +Inquiry |
FAM3D-365H | Recombinant Human FAM3D Protein, His-tagged | +Inquiry |
FAM3D-1775H | Recombinant Human FAM3D protein, His & T7-tagged | +Inquiry |
FAM3D-6743H | Recombinant Human FAM3D protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3D-1947HCL | Recombinant Human FAM3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3D Products
Required fields are marked with *
My Review for All FAM3D Products
Required fields are marked with *
0
Inquiry Basket