Recombinant Human FAM3D Protein, His-tagged
| Cat.No. : | FAM3D-365H |
| Product Overview : | Recombinant Human FAM3D fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Molecular Mass : | 23.12 kDa |
| AA Sequence : | YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | FAM3D family with sequence similarity 3, member D [ Homo sapiens ] |
| Official Symbol | FAM3D |
| Synonyms | FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7; |
| Gene ID | 131177 |
| mRNA Refseq | NM_138805 |
| Protein Refseq | NP_620160 |
| MIM | 608619 |
| UniProt ID | Q96BQ1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3D Products
Required fields are marked with *
My Review for All FAM3D Products
Required fields are marked with *
