Recombinant Human FAM46C protein, GST-tagged
| Cat.No. : | FAM46C-301100H |
| Product Overview : | Recombinant Human FAM46C (1-67 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-His67 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | FAM46C family with sequence similarity 46, member C [ Homo sapiens ] |
| Official Symbol | FAM46C |
| Synonyms | FAM46C; family with sequence similarity 46, member C; protein FAM46C; FLJ20202; |
| Gene ID | 54855 |
| mRNA Refseq | NM_017709 |
| Protein Refseq | NP_060179 |
| MIM | 613952 |
| UniProt ID | Q5VWP2 |
| ◆ Recombinant Proteins | ||
| FAM46C-254C | Recombinant Cynomolgus Monkey FAM46C Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM46C-1906R | Recombinant Rat FAM46C Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM46C-351H | Recombinant Human FAM46C Protein, MYC/DDK-tagged | +Inquiry |
| FAM46C-2249R | Recombinant Rat FAM46C Protein | +Inquiry |
| FAM46C-1815C | Recombinant Chicken FAM46C | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM46C-6374HCL | Recombinant Human FAM46C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM46C Products
Required fields are marked with *
My Review for All FAM46C Products
Required fields are marked with *




